PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009607844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 280aa    MW: 31950.8 Da    PI: 6.505
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009607844.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-172269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEde+l +++++ G g+W+t +++ g+ R++k+c++rw +yl
   XP_009607844.1 22 RGPWTPEEDEILTNYINKEGEGRWRTLPKKAGLLRCGKSCRLRWMNYL 69
                     89******************************99************97 PP

2Myb_DNA-binding49.97.3e-1675120148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg  +++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
   XP_009607844.1  75 RGHISPDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 120
                      67779*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-231472IPR009057Homeodomain-like
PROSITE profilePS5129416.081769IPR017930Myb domain
SuperFamilySSF466891.36E-2919116IPR009057Homeodomain-like
SMARTSM007171.9E-132171IPR001005SANT/Myb domain
PfamPF002495.0E-152269IPR001005SANT/Myb domain
CDDcd001675.99E-112469No hitNo description
PROSITE profilePS5129425.24770124IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2573125IPR009057Homeodomain-like
SMARTSM007173.8E-1574122IPR001005SANT/Myb domain
PfamPF002491.0E-1475120IPR001005SANT/Myb domain
CDDcd001677.14E-1279120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MRTPTSSKTK VTACCSKVGL KRGPWTPEED EILTNYINKE GEGRWRTLPK KAGLLRCGKS  60
CRLRWMNYLR PSVKRGHISP DEEDLILRLH RLLGNRWSLI AGRIPGRTDN EIKNYWNTHL  120
SKKLISQGIN PRTHKPLINH NCSSDDHITN KASSSSPSSS SKLANDFNTI PNPICIPFQM  180
EEPLRSININ HPREITSLDN YQYQSNAMLA NYDDDLNIVV EEDDEMNCCT DDVFSSFLNS  240
LINEDMFNSQ NQQITNGMFP DFDPLVTPTQ DNQDNHQESG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25201245108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607844.10.0PREDICTED: transcription repressor MYB5-like
RefseqXP_016451948.10.0PREDICTED: transcription repressor MYB5-like
SwissprotQ388504e-83MYB5_ARATH; Transcription repressor MYB5
TrEMBLQ2TCH01e-143Q2TCH0_PETHY; PH4
STRINGSolyc01g005660.1.11e-130(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-84myb domain protein 5